PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn335271
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family HB-other
Protein Properties Length: 1742aa    MW: 195607 Da    PI: 4.8953
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn335271genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.63.7e-172578356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                kR   t++qle+Le+ ++ + yps++ r++L+ +lgL++rq ++WF+ rR k++
  Achn335271 25 KRKMKTASQLEILEKTYAVETYPSEALRADLSVQLGLSDRQLQMWFCHRRLKDR 78
                89999***********************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-16979IPR009057Homeodomain-like
SuperFamilySSF466892.48E-141979IPR009057Homeodomain-like
PROSITE profilePS5007115.8392080IPR001356Homeobox domain
SMARTSM003891.5E-142284IPR001356Homeobox domain
CDDcd000865.86E-122380No hitNo description
PfamPF000468.4E-152578IPR001356Homeobox domain
SMARTSM005711.5E-22527586IPR018501DDT domain
PROSITE profilePS5082717.031527586IPR018501DDT domain
PfamPF027911.1E-16529583IPR018501DDT domain
PfamPF050661.6E-15709777IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156124.4E-9932976IPR028942WHIM1 domain
PfamPF156133.3E-1111171189IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1742 aa     Download sequence    Send to blast
MEEGGSGGGS EVEKKKRPEG ENKVKRKMKT ASQLEILEKT YAVETYPSEA LRADLSVQLG  60
LSDRQLQMWF CHRRLKDRNT PPVKRPKKDS TVAAASSSGV GNEKVVGEVG NEHASGSGSG  120
SSPFGHVESQ QQRVALRTGA AIARIATDMP PLKRYYEPPQ AISELRAIAF VEAQLGEPLR  180
EDGPILGMEF DPLPPVSVGQ QKPVTRHFES NLYERTDAKP IKGAVRSLHE YQFLPEQPSV  240
RNDSFERAAP SHYYGSSTDV PSARSALSTG RSYMHGNEQV PPAYGFQGQT PSLSLLPHQG  300
RQSHLLPSTS VEYDTVSQKT SVANIGTDAH FGAHPITALD NPFIPSERQV CTQSEEARLA  360
REVEAHEKRI RKELEKQDIL RRKREEQMKK EMERQDRERR KEEERLLREK QREEVRYQRE  420
QRRELERREK FLQKESIRAE KLRLKEELRR EKEAARQKAA SDRATARRIA KESMELIEDE  480
RLELMELAAS SKGLPSILSL DDKLIVFPPK SVNLKRPFAI KPWCDSEENT GNLFMVWRFL  540
ITFADVLGLW PFTLDEFVQA FHDYDPRLLG EIHIALLRSI IKDIEDVART PSTGLGTNQN  600
CAANPGGGHP QIVQGAYVWG FDIRSWQRHL NPLTWPEILR QFALAAGYGP KLKKRSIEQA  660
YIRDENEGDD GEDIISNLRN GAAAENAVAI MQERGFSNPS RSRHRVTPGT VKFAAFHVLS  720
LEGSDGLTIL EVAERIQKSG LRDLTTSKTP EASIAAALSR DTKLFERTAP STYCVRSPYR  780
RDPADAEAIL SAAREKIQIF KNGYLDGEDA EDVEHDDVER DEDSESDVAE DPEADDLGTE  840
MKPNSETLSC EANRFLTKTY PGDGKEASCD EVMRTPQVGP KNLAGSSPLM QSEGYKGVKS  900
TSTSVDQFID VARISNEADN LDQEDTVIDE SNSGEPWVQG LVEGEYSDLS VEERLSALVA  960
LIGVANEGNS IRVVLEDRLE AANALKKQMW AEVQLDKRRM KEDFVMKMQY SSFMSDKSEP  1020
NIQFSSAEGR QSPLPAVDDK NVLASTNPVI QQEHIQDSQN DTNYCTPIHT ERNQSIQEFS  1080
AGTDNHPLLQ PGFAAERSRS QLKAYIGHKA EEMYVYRSLP LGQDRRRNRY WQFITSASRN  1140
DPGSGRIFVE LRDGCWRLID SEEDFDALLE SLDVRGSKES NLHSMLQKVE VSSKETLRKN  1200
LVHTKTEQLT VDNIKNEVAE MASKPDCSVS TDSPTSTCCV SNSDLPEPSS SFAIGLGRNE  1260
TEKKDAVKRY QDLEKWMWEE CLNSSVLRAI KFGKKRCKQL LDICDYCLDL YLSEDNYCPS  1320
CHRTSETSME DNNFSEHVAQ WRKKFEAEAI QPDWSESYRK SWGTKLHAAL SAEDLLQILT  1380
LLEGAIKKDF VSSNFETTNE LLGYCKRTES AANLSLNPEM IAVLPWIPQT SSAVALRLME  1440
LDASISYMLH QKVDCYKDKG AGDFFALSSK FALAKSIPED DLTEAPHEAE NLLQEPWIDH  1500
GSVRSSSGRG RGGRGRGRGR TRGGRSQRRS ISSRSVAAPR STTTNNERFG QLLGWKGRSR  1560
GRGGRKRSRR TARSRQKPVK RVADIGSERD QQKEIFFDNT VRSLDPQWNR EETMEIQVEA  1620
AENASSSERS EYDDYNGLAA GDEYDDLLPN EYSSVFNGKS DHLIPGVDYN VDGEEDDDDR  1680
VEGDDDVDDE EEDDSEQDEQ VDTDVERYIN SDSDDEGNQD GGEQIGNPDE ATGSTSSDFS  1740
D*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
115101518RGGRGRGRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010657007.10.0PREDICTED: uncharacterized protein LOC100250601 isoform X1
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLA0A067JX120.0A0A067JX12_JATCU; Uncharacterized protein
STRINGPOPTR_0017s04760.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21422352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.20.0Homeodomain-like transcriptional regulator